PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9426_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 336aa    MW: 37469.7 Da    PI: 5.2718
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9426_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.41.2e-082622942355
                                          SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                             Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                          +yp+++e+ +L++ +gL++rq+ +WF N+R ++
  cra_locus_9426_iso_1_len_1546_ver_3 262 PYPTEDEKNKLSEITGLDQRQINNWFINQRKRH 294
                                          8*****************************885 PP

2ELK38.72.1e-13214235122
                                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                          ELK++L+rKYsgyL+sL++EF+
  cra_locus_9426_iso_1_len_1546_ver_3 214 ELKEMLMRKYSGYLSSLRKEFL 235
                                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.5E-1963107IPR005540KNOX1
PfamPF037902.4E-1965106IPR005540KNOX1
SMARTSM012567.7E-24110161IPR005541KNOX2
PfamPF037912.0E-23114160IPR005541KNOX2
SMARTSM011883.1E-7214235IPR005539ELK domain
PROSITE profilePS5121311.383214234IPR005539ELK domain
PfamPF037892.2E-10214235IPR005539ELK domain
PROSITE profilePS5007112.438234297IPR001356Homeobox domain
SuperFamilySSF466891.07E-18236308IPR009057Homeodomain-like
SMARTSM003897.3E-13236301IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-25239299IPR009057Homeodomain-like
CDDcd000862.33E-12250298No hitNo description
PfamPF059207.1E-16254293IPR008422Homeobox KN domain
PROSITE patternPS000270272295IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MDELYRIHSS FSSSNGTGHI VEVVHGRGNN NNMEEVVNGL RAAVGHGHDE SHQVNIIGSE  60
MSDVLKAQIA NHPFYPNLVS AYIQCRKVGA PPELASILEE ISKENHPLAS PSEMGTDPEL  120
DQFMESYCEA LNKYKEELLK PFDEATTFLN NIESQLSNLC KENYMATTTT TSSLTSGNYH  180
SDEAGVTSDE DLSCGEVEVA ESQESSGGGQ AENELKEMLM RKYSGYLSSL RKEFLKKRKK  240
GKLPKNARLA LLDWWNTHYR WPYPTEDEKN KLSEITGLDQ RQINNWFINQ RKRHWRPSED  300
MRFALMQGVT STLAGPPMYF DAAGGGPPGH GGGFGS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1229238LRKEFLKKRK
2235239KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016499152.11e-137PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_016499153.11e-137PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-100KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A068VEZ61e-155A0A068VEZ6_COFCA; Uncharacterized protein
STRINGVIT_14s0060g01180.t011e-131(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480